SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010888 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010888
Domain Number 1 Region: 434-824
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.95e-133
Family Ankyrin repeat 0.000000000174
Further Details:      
 
Domain Number 2 Region: 85-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.98e-108
Family Ankyrin repeat 0.000000134
Further Details:      
 
Domain Number 3 Region: 4069-4179
Classification Level Classification E-value
Superfamily DEATH domain 1.24e-25
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010888   Gene: ENSSSCG00000010212   Transcript: ENSSSCT00000011178
Sequence length 4363
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:68392355:68781879:-1 gene:ENSSSCG00000010212 transcript:ENSSSCT00000011178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEETEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREASVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNDASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETMTTTTIIEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAVTGDTDKYLGPQDLKELGDDSLPAE
GYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFS
PIVTVEPPPPSGEGASNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSF
TTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTD
DKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFKENRL
PFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDPDDEMEKTE
RRQTFASLALRKRYSYLTEPGMKTVERSAGATRSLPTTYSYKPFFSTRPYQSWTTAPITV
PGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSVKSISDVASPIRS
FRTISSPIKTVVSQSPYNIQVSSGTLVRAPTVTEASPLKGLASNSTFSPRTSPVTTAGSL
LERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSSAKPTVDVVSAAK
VTMASSLSSPVKQMPGPAEVVLVNGSISPLKYPSSSTLMNGCKATATFQEKISTATNSVS
SVLNAASDTVEKAYPVTTAMPFSPLRSFVSPAPSAFQALRTPSASALYTSLGSSLSATTS
SVTSSVITVPVYSVVSVLPEPAFKKLPDSNSLTKSAAALLSPVKTLATETRPQPHFPRTA
SPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPEEKPFQPEL
PKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVEDKGPPKSPKSDKGHSPEDDWIEFS
SEEIREARQQAPTSPAPSLPERVQVKAKAASEKDYNLTKVIDYLTNDIGSSSLTNLKYKF
EDVKKDGEERQKRILKPAIALQEHKLKMPPASMRPSTSEKELCKMADSFFGTDTILESPD
DFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHDVPIPPVITETRTEVVHVI
RSYEPSAGDAPPSQPEEPVSPKPSPPFMELEPKPTPSTIKEKVKAFQIKASGEEDEHGRV
LGKGMRVKEETHITTTTRMVYHSPPGSEGASERIEETMSVHDIMKAFQSGRDPSKELAGL
FEHKSTVSPDAHRSAAETSAQHAEKDHQMKPKLERIIEVHIEKGNQAEPTEVIIRETKKH
PEKEMYVYQKDLSRADINLKDFLPEKHDAFPCPEEQGQQEEEELTAEESLPSYLESSRVN
TPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGESYRFAEKMLLSEKL
DVSQSDTEESVTDHAGPPSSELQGSDKRPREKVVTAPPKEILSKVYKDVSENGVGKVSKD
EHFDKVAVLHYPADVSGPKQAMWMRLAEDRLERGREKLIYEDRVDRTVKEAEEKLTEVSQ
FFRDKTEKLNDELQSPEKKPRPRNGKEYSSQSPPGSSPEKALLASSEEWVKARQPGRDGE
GCPKADERNAASPPSSPETVLSQQTEDSKATEEAKASISQSKEPEGPPSGFQLKQSKLSS
IRLKFEQGAQAKSKDVSQEDKKPEGQSRIPVKKIQESKLPVYQVFAREKPQKASDESGSA
PKDLMVLKAKDEHAQSNEIVVNDSGSDDVKKQRPEMSSKVMPDSFSEQQAKDLACHVTSD
VATKGPWDQKVFRTWESSGAPNNKPQKEKLSHVLVHDVRENHAGHPESKIVDQRDAFLSV
TEREHTLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGERPGGSLDQPPRRSDSSAVSHI
PVRVAGERTTPTSNIPDGFFEPPVFPKHELSPKLSQSRMSQETVETQHFNSIDKEKVTYS
EISKVSKHQSYVGLCPPFEETEVSPIKSPDSLEFSPGKESPSSDVFDRSPIDGLEKAAPL
VQTEGGKEIRTLPVYVSFVQVGKQYEKEIQQGGVKKIVSQECKTVQETRGAFYTTRQQKQ
PPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYEFTSKTPDSLIAYIPGKPSPI
PEVSEESEEEEPAKSASLKPTAAEGTAAIEREAPPDVSKDSSQRPKSNRVAYIEFPPPPP
LDADPVESDRKHPHLPEREVDLIEVSLQDEHDKDQLAEPVIRVQPPSPVPPGADVSDSSD
DESLYQPVPVKKYTFKLKDVDDEQKERTPPKTSTGKGSDQKALVEVNGSGKEHDFGLGLD
SPQNETAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDLQDEDDGLTESDSKLPS
QTLEVKKDIWNTEGILKPADRSFSQSKLEVIEEEEGRVGPDEEKPPPRSSSSEKSSDKTD
PKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWSNNRGDDDVY
DGKSREDESKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSG
AIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSMVTATPQPQAGDTTVDTNVESNV
EAPSVEPQPSILTSGECQEGTASSGSQEKAAAAANASKVDPKLRTPIKMGISASTMTMKK
EGPGEVTDKIEAVMTSGQGLENETITVISNTANSLTGVRPQDKHDFQRDNFNNNNNLDSA
TIQTDNITSHVVLTEHSAPTCTTKKANPVRSSPGKKTGVLQGHCVRDKQKVLGEQQKAKE
SIGIRRKSKLPIKATSPKELLPPNHMPNINVSKMKQASQSEKTKTLTASSCVDVKSRIPV
KDTHRDDTGSLRKPCATQKQGQPEKGRAKQLPSKLPVKVRSTCVTTTSTTPTTSTTPTTT
TTTTTTTVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEDKKMQSEVSDEEDSTSR
NTSLSETSRGGQPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRRTGPQSPCERTDIRM
AIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDAL
TSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENSVFHDPVDGWQNETSSGNLEPPAQ
ARRITGGLLDRLDDSPDQCRDSITSYLKGEPGKFEANGSHAEVTPEAKTKSYFPESQNDV
GKQSAKETLKPKIPGPGRVDEPSSSLAAYQKALEETSKFVIEEPKPCMPVSMKKMSRTSP
TDGKPRLNLHEEEGSNGSEQKQGEGYKVKTKKEIRHVEKKSHS
Download sequence
Identical sequences ENSSSCP00000010888 ENSSSCP00000010888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]