SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010945 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010945
Domain Number 1 Region: 23-155
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 3.01e-23
Family Outer arm dynein light chain 1 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010945   Gene: ENSSSCG00000010267   Transcript: ENSSSCT00000011237
Sequence length 180
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:79134988:79214217:-1 gene:ENSSSCG00000010267 transcript:ENSSSCT00000011237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVTDQIHLITLANNELKS
LTSKFMTTFSQLRELHLEGNFLHRLPNEVSTLQHLKAIDLSRNHFHDFPEQLTTLPALET
INLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPPP
Download sequence
Identical sequences ENSSSCP00000010945 ENSSSCP00000010945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]