SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011047 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011047
Domain Number 1 Region: 6-89
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 624-688
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-18
Family LIM domain 0.0095
Further Details:      
 
Domain Number 3 Region: 565-628
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.92e-18
Family LIM domain 0.0099
Further Details:      
 
Domain Number 4 Region: 532-563
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000285
Family LIM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 684-708
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000153
Family LIM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011047   Gene: ENSSSCG00000010359   Transcript: ENSSSCT00000011341
Sequence length 715
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:94915443:94974092:1 gene:ENSSSCG00000010359 transcript:ENSSSCT00000011341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTAVPPIQSPLPVIPHQKDPALDANSSLAAP
SPHPEARASPGTPGTPEHGLTFSSSFSQTSVFSSHTEASDLGPPRGSPGAKTSLEGALDS
LSLKGPLGSSQPRQYNNPIGLYSAETLREMAQMYQMSLRGKASGAGLLGGSLPIKDLTVD
SASPVYQAVIKNQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEYMQDPDEEALRRSST
PIEHAPVCTSQAATPLLPASAQPPAAASPSTASPPLATAAAHTATASAAAPASSPADSPR
PQASAYSPAVATSPAPAAHTYSEAPAAPAPKPRVVTTASIRPSVYQPVPASTYSPSPGAN
YSPTPYTPSPAPAYTPSPAPTYSPSPAPAYTPSPAPSYNPTPYSGGPAESASRPPWVTDD
SFSQKFAPGKSTTSISKQSLPRGAPAYTPPLQGPQVSPLARGTVQRAERFPASSRTPLCG
HCNSIIRGPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPVCAK
CNTKIMGEVMHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKDYVNLFSTKCHGC
DFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDKPLCKKHAHAINV
Download sequence
Identical sequences ENSSSCP00000011047 ENSSSCP00000011047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]