SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011169 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011169
Domain Number 1 Region: 483-835
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.5e-113
Family PDEase 0.000000248
Further Details:      
 
Domain Number 2 Region: 236-281,308-458
Classification Level Classification E-value
Superfamily GAF domain-like 7.06e-31
Family GAF domain 0.00077
Further Details:      
 
Domain Number 3 Region: 61-250
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-30
Family GAF domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011169   Gene: ENSSSCG00000010480   Transcript: ENSSSCT00000011468
Sequence length 859
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:114783714:114853738:1 gene:ENSSSCG00000010480 transcript:ENSSSCT00000011468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEISQESVEKYLEDNPQFAKEYFDKKLRVEAGGESSQPGGAQASASFPGLTLAEEAAVC
LELLGILREEAGSAELAVHRALQRLAQLLQADRCSMFLCRARNGTPEVASKLLDVTPTSK
FEDNLVVPDREAVFPLDVGIVGWVAHTKKTFNVPDVKKNNHFSDFMDKQTGYVTRNLLAT
PIVMGKEVLAVIMAVNKVDAPEFSKQDEEVFSKYLNFVSVILKLHHTNYLYSIESRRSQI
LMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGEVE
PYKGPKTPDGREIIFYKIIDYILHGKEEIKVIPTPPTDHWTLVSGLPTYVAENGFICNML
NAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEYDEHIT
ETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATPDEIESILKFKEKLNIDVI
EDCEEKQLVTILKEDLPDPQAADLYEFRFSDFPITEHGLIKCGLRLFFEINVVEKFKVPV
EVLIRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGKLKKYYTDLEAFAMLAAAFCH
DIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVI
HLFEVAIIATDLALYFKKRTMFQKIVDACEKMETEEEAIKYVTIDPTKKEIIMAMMMTAC
DLSAITKPWEVQSQVALLVASEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFIDF
VCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEMKKQEEGNTTEKA
AEDAGGGGDDKKSKTCLML
Download sequence
Identical sequences F1SC79
ENSSSCP00000011169 XP_003133198.1.46622 ENSSSCP00000011169 9823.ENSSSCP00000011169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]