SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011180 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011180
Domain Number 1 Region: 286-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000563
Family LIM domain 0.00091
Further Details:      
 
Domain Number 2 Region: 253-285
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000113
Family LIM domain 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000011180
Domain Number - Region: 6-41
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00338
Family PDZ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011180   Gene: ENSSSCG00000010493   Transcript: ENSSSCT00000011481
Sequence length 330
Comment pep:novel chromosome:Sscrofa10.2:14:116376967:116425960:-1 gene:ENSSSCG00000010493 transcript:ENSSSCT00000011481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVRAAGDARLINKCLSRIVTPESGRYSGT
VKKIDADQQYRGLKKNFFLTILAGSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSA
HNRSAMPFTASPASSASPRIITNQYNNPAGLYSSENISSFNSALESKTAASGQETNGRAL
DHSQLPSGLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRS
VKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHF
FVEDQIYCEKHARERVIPPEGYDVVTVFPK
Download sequence
Identical sequences ENSSSCP00000011180 ENSSSCP00000011180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]