SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011193 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011193
Domain Number 1 Region: 303-509
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.76e-65
Family DNA polymerase beta-like 0.0000000276
Further Details:      
 
Domain Number 2 Region: 150-241
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.27e-30
Family DNA polymerase beta, N-terminal domain-like 0.00000973
Further Details:      
 
Domain Number 3 Region: 243-301
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.18e-17
Family DNA polymerase beta-like, second domain 0.0000491
Further Details:      
 
Domain Number 4 Region: 38-124
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000589
Family DNA ligase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011193   Gene: ENSSSCG00000010505   Transcript: ENSSSCT00000011494
Sequence length 510
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:117385455:117419194:1 gene:ENSSSCG00000010505 transcript:ENSSSCT00000011494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPPQTVPSSPRKKRPRQVGASMASPAHNIKFRELVLFILEKKMGTTRRTFLMELARRKG
FRVENELSDSVTHIVAENNSGSEVLEWLQAQKIRASSQLTLLDVSWLIESMGAGKPVEMT
GKHQLVVRTDCSASPSPGSQNTLPPAVKKISQYACQRRTTLNNCNHIFTDAFEVLAENYE
FRENETFCLAFMRAASVLKSLPFTIISMKDTEGIPCLGDKVKCVIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSERWFRMGFRSLSKIRSDKTLKFTRMQKAGFLYYEDLV
SCVTRAEAEAVGVLVKEAVQAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTDDEEQQ
LLPKVVNLWEREGLLLYCDLVESTLEKSKLPSRNVDALDHFQKCFLILKLHHQRVDSGMS
SQQEGKTWKAIRVDLVMCPYELRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDK
TKRIFLKAESEEEIFAHLGLDYLEPWERNA
Download sequence
Identical sequences F1SBG2
ENSSSCP00000011193 9823.ENSSSCP00000011193 ENSSSCP00000011193 XP_003133204.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]