SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011254 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011254
Domain Number 1 Region: 386-574
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.16e-59
Family DNA polymerase beta-like 0.0000000195
Further Details:      
 
Domain Number 2 Region: 237-328
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.4e-28
Family DNA polymerase beta, N-terminal domain-like 0.00000859
Further Details:      
 
Domain Number 3 Region: 330-384
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.11e-17
Family DNA polymerase beta-like, second domain 0.00012
Further Details:      
 
Domain Number 4 Region: 40-132
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000048
Family BRCT domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011254   Gene: ENSSSCG00000010564   Transcript: ENSSSCT00000011556
Sequence length 575
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:122351909:122359836:-1 gene:ENSSSCG00000010564 transcript:ENSSSCT00000011556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRGILKAFPKRRKIHTSPSSKALAKIPKREDGEEAGEWLSSVRAHVVPTGIGRARAEL
FEKQIVQHGGQLCPAQAPGVTHIVVDEGMDCERALRLLRLPRLPPGAQLVKSAWLSLCLQ
ERRLVDTAGFSIFIPERYLDQAQLSKAGNDSSTSPGARETPLRTALSPPSPPTRPVSPSE
RTEEFASIQAQPGSDGDTSDGEETQVSAADLEALISGRYPTPLEEDGEPSPAPKGLDKWV
CAQPSSQKATNHNPHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
AIPGIGKRMAEKILEILESGHLRKLDHISESVPVLQLFSNIWGAGTKTAQLWYHQGFRSL
EDIRNQASLTTQQAIGLKHYHDFLDRMPREEASEIEQTVREAAQAFNPGLLCVACGSYRR
GRATCGDVDVLLTHPDGRSHQGIFSRLLDSLRQRGFLTDDLVSQEQHGQQQKYLGVCQLP
GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRDA
HGLKVGLGRVLPTPTEKDVFRLLGLPYREPAERDW
Download sequence
Identical sequences F1S8U1
ENSSSCP00000011254 9823.ENSSSCP00000011254 ENSSSCP00000011254 XP_001926893.1.46622 XP_005671452.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]