SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011271 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011271
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.28e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000994
Further Details:      
 
Domain Number 2 Region: 226-358
Classification Level Classification E-value
Superfamily E set domains 6.07e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 735-813
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000126
Family DEATH domain, DD 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000011271
Domain Number - Region: 558-596
Classification Level Classification E-value
Superfamily UBA-like 0.00778
Family CUE domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011271   Gene: ENSSSCG00000010580   Transcript: ENSSSCT00000011573
Sequence length 865
Comment pep:known chromosome:Sscrofa10.2:14:123262121:123270684:1 gene:ENSSSCG00000010580 transcript:ENSSSCT00000011573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSCYDPSLPGIIEYDDFKFNPSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGSAGGYGGAGGGVFFSFFLSFFFFFELKNRGSGPASGQWGGERWGEVTGGKRREHGAGE
DRQYSPPCLCPDAPPRGRPQMMEAYVPGFAHIPRWGLAGARGGGGMADCGRVILLLPSLL
FQEYNRGHDAEALRAENLQPQSSAVQGQVSASSETLQRPENLKEETRSSPSAAGDTPDEV
LHLCPQAAGTEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPP
AWDGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEVRQLGLLGPEST
ASTEALAGLSPSLLGSDPRGMQEPYTPTQGTPYLLSPFFPNFPCSTVLTSSWSCHRHSXA
PPLTPPSPAGPEMPLEDTVLQNLEHLLDRPGAQGSWAELAERLGLRSLVDTYRKTASPSG
SLLRSYKLAGGDLAGLLDALSDMGLEEGVRLLRGPETREKLPSTAEVKEDSAYGSQSVEQ
EAEKLGPPPEPPGGLCHGHPQPQVH
Download sequence
Identical sequences ENSSSCP00000011271 ENSSSCP00000011271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]