SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011348 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011348
Domain Number 1 Region: 720-798
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 3.66e-27
Family VHP, Villin headpiece domain 0.0000814
Further Details:      
 
Domain Number 2 Region: 182-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.04e-17
Family LIM domain 0.0035
Further Details:      
 
Domain Number 3 Region: 55-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.49e-16
Family LIM domain 0.0023
Further Details:      
 
Domain Number 4 Region: 112-148
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000439
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 241-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000124
Family LIM domain 0.0021
Further Details:      
 
Domain Number 6 Region: 153-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000111
Family LIM domain 0.0081
Further Details:      
 
Domain Number 7 Region: 17-53
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000779
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011348   Gene: ENSSSCG00000010651   Transcript: ENSSSCT00000011650
Sequence length 798
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:135884829:136136366:-1 gene:ENSSSCG00000010651 transcript:ENSSSCT00000011650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTHHIPKDNQVAHPQDPHHPPEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGC
DLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRP
FPPGDRVTFNGRDCLCQLCAQPMSSSPKEASCPSNCAGCGRDIKNGQALLALEKQWHLGC
FKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCAR
CSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPPNIHRSPSDFFYPKSLIRRTGR
SPSLQLLSPTGLVNFNKNPRQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDL
AAIPKVKAIYDIERPDLITYEPFYSSGYDDKQERQSLGESPRTLSPTPSAEGYQDGRDRA
IHRSTSQGSINSPGYSRHSYTPTTSRSPQHFHRPELLSPGVQRLNFLRTSSFSSTHSDSR
PNSPFRHHFLPHVKGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPP
IYKQHDAAALAAQSKSSEDIIKFSKFPAAQAPDPSEIPKIETDHWPGPPSLAAVELGADT
RRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKERESRERSTLAASRYDS
PINSASHALSSKTSSLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMR
MDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFREIFGMSIQEF
DKLPLWRRNDMKKKAKLF
Download sequence
Identical sequences ENSSSCP00000011348 ENSSSCP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]