SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011519 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011519
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-46
Family Regulator of G-protein signaling, RGS 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011519   Gene: ENSSSCG00000010806   Transcript: ENSSSCT00000011822
Sequence length 212
Comment pep:known chromosome:Sscrofa10.2:10:2543423:2546894:-1 gene:ENSSSCG00000010806 transcript:ENSSSCT00000011822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAMFLTVHHDCGPMDKSAGTGPKSEEKREKMKRTLLKDWKTRLSYFLQNSSSPGKPKT
GKKSKPQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCRKPPQITTEPHAT
Download sequence
Identical sequences D0G7E5 Q3S853
NP_001038065.1.46622 ENSSSCP00000011519 9823.ENSSSCP00000011519 ENSSSCP00000011519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]