SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011676 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011676
Domain Number 1 Region: 341-431
Classification Level Classification E-value
Superfamily DEATH domain 2.24e-19
Family DEATH domain, DD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011676   Gene: ENSSSCG00000010949   Transcript: ENSSSCT00000011984
Sequence length 469
Comment pep:known chromosome:Sscrofa10.2:10:31963682:31970721:-1 gene:ENSSSCG00000010949 transcript:ENSSSCT00000011984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEADLRHIAQQLHSTGEI
NIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDVQRLVPDSDVEEL
LQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEVRVYGGVRIVPVEHLTPFP
CGIFHKVQVNLCRWIHQQSAEGDADIRLWVNGCKIANRGAELLVLLVNHGQGIEVQVRGL
ETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQ
TLKETSLTNTMGGYKESFSSIMCFGCHDVYVQASLGMDIHASDLNLLTRRKLSRLLDPPD
PMGKDWCLLAMNLGLPDLVAKYNTNNGAPKEFLPSPVHALLREWTSYPNSTVGVLMSKLR
ELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
Download sequence
Identical sequences ENSSSCP00000011676 ENSSSCP00000011676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]