SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011927 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011927
Domain Number 1 Region: 121-375
Classification Level Classification E-value
Superfamily Translation proteins 1.92e-73
Family Ribosomal protein L3 0.0000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011927   Gene: ENSSSCG00000011179   Transcript: ENSSSCT00000012242
Sequence length 399
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:763799:803373:1 gene:ENSSSCG00000011179 transcript:ENSSSCT00000012242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAALLPSWGQRGAAAGGGGKAWEGRRRNALKAEWRGAQRCSGRALLGLTMPGWGLLGR
AGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPFVKQLVSDEN
KAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHV
LKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKP
GTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPGAISTGDVA
RVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIKDSKLPAYKD
FCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT
Download sequence
Identical sequences A0A140UHW4
4ce4_E ENSSSCP00000029810 ENSSSCP00000011927 XP_001925073.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]