SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011997 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011997
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-25
Family Protein kinases, catalytic subunit 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011997   Gene: ENSSSCG00000011252   Transcript: ENSSSCT00000012319
Sequence length 180
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:25100244:25121506:-1 gene:ENSSSCG00000011252 transcript:ENSSSCT00000012319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQ
DKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEYLQEKILQRAPTIS
ERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRVSFVKLCASARVLP
Download sequence
Identical sequences ENSSSCP00000011997 ENSSSCP00000011997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]