SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012025 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012025
Domain Number 1 Region: 33-156
Classification Level Classification E-value
Superfamily Lysozyme-like 1.37e-38
Family C-type lysozyme 0.0000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012025   Gene: ENSSSCG00000011279   Transcript: ENSSSCT00000012348
Sequence length 157
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:28656950:28661369:-1 gene:ENSSSCG00000011279 transcript:ENSSSCT00000012348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPGSHPPEREEMKASVVLSLIGYLVVPSGAAVLGRCVVAKKLHEGGLSDYEGYSLENWV
CLAYFESKFNPTAVYDNLRGDYTGYGLFQIRNHDWCDHGKNRCHVSCSALLNPNLKETIK
CAKKIVQGKRGMGAWPSWTLNCQNSDTLARWLDGCKL
Download sequence
Identical sequences 9823.ENSSSCP00000012025 ENSSSCP00000012025 ENSSSCP00000012025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]