SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012132 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012132
Domain Number 1 Region: 10-234
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-53
Family Kelch motif 0.00034
Further Details:      
 
Domain Number 2 Region: 242-340
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-18
Family Kelch motif 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012132   Gene: ENSSSCG00000011379   Transcript: ENSSSCT00000012457
Sequence length 354
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:35007412:35011175:1 gene:ENSSSCG00000011379 transcript:ENSSSCT00000012457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGGGRAFAWQVFPSMPTCRVYGTVAFQDGHLLVLGGCGRTGLPLDTAETLDMASHTWL
ALAPLPTARAGAAAVVLGKQVLVVGGVDEAQSPVAAVEAFLADEGRWERRATLPQAAMGV
ATMERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAMAEGSIFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRAKRADFVVGALGDHIVAIGGLGNQPCPLGSVE
GFSLARRRWEALPAMPTARCSCSSLQAGPWLFAIGGVAQGPSQAVEALCLRDGV
Download sequence
Identical sequences F1SPT3
9823.ENSSSCP00000012132 ENSSSCP00000012132 ENSSSCP00000012132 XP_003132254.1.46622 XP_005669594.1.46622 XP_013837119.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]