SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012249 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012249
Domain Number 1 Region: 175-238
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000309
Family LIM domain 0.062
Further Details:      
 
Domain Number 2 Region: 235-302
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000148
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012249
Domain Number - Region: 298-321
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00357
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012249   Gene: ENSSSCG00000011495   Transcript: ENSSSCT00000012578
Sequence length 858
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:50099800:50263925:-1 gene:ENSSSCG00000011495 transcript:ENSSSCT00000012578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KICLHCKCPQEEHMVTVMPLAMEKTVSKLMFDFQRNSTSDDDSGCALEEYAWVPPGLKPE
QVHQYYSCLPEEKVPYVNSPGEKLRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSNQ
RKRENLGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFICTVCNE
LLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECET
VLGGQRYIMKEGRPYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFCCAH
CKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKT
EEPMLNQHSQLQVSSNRLSADVDPLSLQMDLLSLSSQTPSLNRDPIWRSRDEPYHYGNKM
EQNQSQSPLQLLSQCNIRTAYSPGGQGAGAQPDLWAKHFSNPKRSSSLAMKGHGGSFIKE
CREDYYPARLRSQESYSDMSSQSFSETRGSIQVPKYEEEEEEEEGGLSAQQCRTRHPISS
LKYTEDMTPTEQTPRGSMESLALSNTTGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEK
LSNMGTLNSSMQFRSAESVRSLLSAQQYQEMESNLHPLGNPIGYRDLQAHGRMHQSFDFD
GGIAGNKLPGPEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLASERE
AISRLKERPPLRAREDYDQFMRQRSFQESLGQGSRRDLYGRCPRTVSDLALQNAFGDRWG
PYFTEYDWCSTCSSSSESDNEGYFLGEPIPQPAHLRYVTSDELLHKYSSYGLPKSSTLGG
RGQLHSRKRQKSKNCIIS
Download sequence
Identical sequences ENSSSCP00000012249 9823.ENSSSCP00000012249 ENSSSCP00000012249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]