SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012339 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012339
Domain Number 1 Region: 239-502
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-82
Family Nuclear receptor ligand-binding domain 0.00000000017
Further Details:      
 
Domain Number 2 Region: 135-220
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012339   Gene: ENSSSCG00000011579   Transcript: ENSSSCT00000012672
Sequence length 504
Comment pep:known chromosome:Sscrofa10.2:13:75578055:75650239:1 gene:ENSSSCG00000011579 transcript:ENSSSCT00000012672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETLGDSLIDPESDAFDTLSANISQEVTMVDTEMPFWPTNFGISSVDLSVMDDHSHSFD
IKPFTTVDFSSISTPHYEDIPFPRADPMVADYKYDLKLQDYQSAIKVEPVSPPYYSEKTQ
LYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCR
IHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRA
LAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQ
SKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFVNLDLNDQVTLLKYGVHEIIYTMLASL
MNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIIL
SGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLL
QVIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences O62807
9823.ENSSSCP00000012339 ENSSSCP00000012339 NP_999544.1.46622 ENSSSCP00000012339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]