SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012382 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012382
Domain Number 1 Region: 114-204
Classification Level Classification E-value
Superfamily Translation proteins 1.06e-22
Family Elongation factors 0.00076
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000356
Family G proteins 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012382
Domain Number - Region: 207-254
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0403
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012382   Gene: ENSSSCG00000011619   Transcript: ENSSSCT00000012716
Sequence length 491
Comment pep:novel scaffold:Sscrofa10.2:JH118478.1:115490:198136:1 gene:ENSSSCG00000011619 transcript:ENSSSCT00000012716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSGAQIIDLMMLVIDVTKGMQTQSAECLVIGQIACQKLVVVLNKTDLLPEGKRQAAIEK
MTRKMQKTLENTKFRGAPIIPVAARPGGPEAPETEAPQGIPELIELLTSQISIPARDPSG
PFLMSVDHCFSIKGQGTVMTGTVLSGSVSLGDSVEIPALKVVRKVKSMQMFHTPVTSAVQ
GDRLGICVTQFDPKLLERGLVCAPESLHTVHAAVISVEKIPYFRGPLQTKAKFHITVGHE
TVMGRVMFFSPAPDSFDHKPVLDSFDFSQEYLFQEQYLCPSSAPAATDTTDSGGDDKKAG
QASEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDADIHANTCRLAFHGVLLHGLEDKNY
AESCLPKLRVYKLKHKHGVVERVMDDYSVIGRTNIQLFVGLKVHLSTGELGVIDSAFGQS
GKFKVHIPGGLSPESKKILTPALKKRGRAGRGEAAKQEEGAERLEPTQHVELSLSFKRYV
FDTHKRMVQSP
Download sequence
Identical sequences ENSSSCP00000012382 ENSSSCP00000012382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]