SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012733 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012733
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.13e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012733   Gene: ENSSSCG00000011952   Transcript: ENSSSCT00000013078
Sequence length 157
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:166892683:166899134:1 gene:ENSSSCG00000011952 transcript:ENSSSCT00000013078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK
KGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences G1LAN3 M3YJY7 W5QAY7
ENSCPOP00000016020 ENSMPUP00000011644 ENSCPOP00000016020 ENSSSCP00000012733 ENSMPUP00000011644 ENSOARP00000019882 ENSAMEP00000003956 ENSAMEP00000003956 ENSSSCP00000012733 10141.ENSCPOP00000016020 9615.ENSCAFP00000014113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]