SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012803 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012803
Domain Number 1 Region: 136-308
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.38e-23
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0038
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000687
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012803   Gene: ENSSSCG00000012021   Transcript: ENSSSCT00000013152
Sequence length 337
Comment pep:novel chromosome:Sscrofa10.2:13:199001550:199018936:-1 gene:ENSSSCG00000012021 transcript:ENSSSCT00000013152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEAMAMGAWGLRLWRAVPRGEAGWRLIATSPASQLSPTELIEMQNDLFNKEKNRQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFC
YDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFI
EEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVRRFQGLS
LPVHLRAHFTIWNKLLERSRKMVTEDKTKPTEESAST
Download sequence
Identical sequences ENSSSCP00000012803 ENSSSCP00000012803 9823.ENSSSCP00000012803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]