SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012842 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012842
Domain Number 1 Region: 232-340
Classification Level Classification E-value
Superfamily TPR-like 3.13e-28
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 2 Region: 488-604
Classification Level Classification E-value
Superfamily TPR-like 0.000000108
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012842
Domain Number - Region: 821-896
Classification Level Classification E-value
Superfamily DEATH domain 0.00824
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012842   Gene: ENSSSCG00000012062   Transcript: ENSSSCT00000013194
Sequence length 1497
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:210781584:210875732:1 gene:ENSSSCG00000012062 transcript:ENSSSCT00000013194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDFALGNVTVADYALLEDCAYVDDCVFAPDFMSSDYVRVTQLYCDGVGRQYKDYTQSER
NLEFDICTMWCSKPISVLQDYCDAIKIHVFWPLLFQRQHSSVLSRLHPCVEANSSPASEI
SLKKLQHLELMEDIVDLAKKVVVRSFFIGGLLRNGYKIENKILAMEEALNWVKYTGDVTI
LPKLGAVDNCWPMLSIFFTEYKYHITKVVTENCNLLEEFKTQNCAECIEQGELMKMKGNE
EFSKERFDIAIIYYTRAIECRPENHLLYGNRALCFLRTGQFRNALGDGKRAIILKNNWTK
GHYRYCAALSMLGEYDWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQIEDLQGLTPTR
NPIKAFYESRAYIPNLSAPAFSTSLNFVETERNSRKTNHEMANGGNQNLKAVDEASKVDD
CDCHPEFLPPSSQPPKYKGKQKSRNNELEKFSSDSQGSLPVDLKNILEKQFSKSSRAAHQ
DFANIMKMLRSLIQDGYTALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLVVYG
LAISLLGIGQPEELSEAENQFKRMIEHYPNEGLDCLAYCGIGKVYLKKNRFLEALNHFEK
AKTLICRLPGVLTWPTSNVVIEETQPGKIKMLLEKFIEECRFPPVPDAICCYQKCRGYSK
IQIYITDPDFKGFIRISCCQFCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCEGI
ISKIIIFSSGGQVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKKMKRKIQKKEAK
KLAQERMEEDLRESNPPKTEEQKETIGSVQSCQFLDDRILQCIKQYADKIKSGILNTSKL
LKELLSWKVLTTEDYTTCFSSRNFLNEAVDYVIRHLIQEKNRVKTRVFLHVLSELKEVEP
KLAAWIQKLNSFGLDATGPFFSRYGASLKELDFSIMTFLWNEKYGHKLGSIEGKKLDYFY
EPTSLKEARCLIWLLEEHRDKFPALHNALDEFFDIMDSRCTVLRKQDSGDVPFNSTKIKN
KGKKKKPKDSKPMLVGSGTSSVTPNNETITSGEDISKRNSNSAGPFVVPDHLRQDVEEFE
ALYEQHSNEYVVRNKKLWDINPKQKCSTLYDYFSQLLEEHGPLDMSNKMFSEEYEFFPEE
TRQILEKAGGLKSFLLGCPRFVVIDNCIALKKVALRLKKKRKKKNIKTKVEEISKTGEYL
RVKLPLNPAAREFKPDVKSKPVSDLSSAPASEDLKPQPTCTNSAQPACEAVKPKPISDNS
SRSVSEDAKPKGVSSDPPKPVSEEAGHKQVSNCPKPILEDVKPTYWPQPHLVTGYCTYLP
FRGFDITQTPPAFINVLPTMPQYSIYTPLATVSSEYQLQRSIPVVPSFVASDITDVRFEG
HHFIAENAPGPQIVPETQILQDSSEIPVKPQCLTDGADTAPSESNRNDGHCGNSAKWEEN
PENTDEVTDTPRTQMVAIQVSWNITHQEVNTEPYNPFEAQQVSQNCIKPFKGLNSLI
Download sequence
Identical sequences ENSSSCP00000012842 ENSSSCP00000012842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]