SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012965 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012965
Domain Number 1 Region: 34-90,128-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.07e-40
Family G proteins 0.00000289
Further Details:      
 
Domain Number 2 Region: 248-362
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-38
Family Elongation factors 0.0000277
Further Details:      
 
Domain Number 3 Region: 364-460
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.1e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012965   Gene: ENSSSCG00000012178   Transcript: ENSSSCT00000013322
Sequence length 472
Comment pep:novel chromosome:Sscrofa10.2:Y:1277624:1297330:1 gene:ENSSSCG00000012178 transcript:ENSSSCT00000013322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGEAGVTLGQPHLSRQDLTTLDVTRLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDASCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPLRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDCEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Download sequence
Identical sequences F1SPY4
ENSSSCP00000012965 ENSSSCP00000012965 XP_005658004.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]