SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012983 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012983
Domain Number 1 Region: 41-93
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000366
Family Toll/Interleukin receptor TIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012983   Gene: ENSSSCG00000012196   Transcript: ENSSSCT00000013341
Sequence length 93
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:28024042:28068942:1 gene:ENSSSCG00000012196 transcript:ENSSSCT00000013341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTVELAGGLGAILLLLVCLVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKV
DPDQWNQETGEEERFALEILPDMLEKHYGYKLF
Download sequence
Identical sequences ENSSSCP00000012983 ENSSSCP00000012983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]