SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013044 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013044
Domain Number 1 Region: 13-318,423-464
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.19e-76
Family FAD-linked reductases, N-terminal domain 0.000000000197
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.4e-36
Family L-aminoacid/polyamine oxidase 0.000000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013044   Gene: ENSSSCG00000012257   Transcript: ENSSSCT00000013404
Sequence length 527
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:43132739:43209051:-1 gene:ENSSSCG00000012257 transcript:ENSSSCT00000013404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQEKANNAGHMVDVVVIGGGISGLSAAKLLNEYGINVLVLEARDRVGGRTYTVRNENV
DYVDVGGAYVGPTQNRILRLSKELGLETYKVNVNECLVQYVKGKSYPFRGAFPPVWNPIA
YLDYNNLWRTMDDMGKKIPADAPWESPHAEEWDKMTMKDLIDKICWTKTAKRFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMHLLGDRVKL
RCPVTYVDQSGDNIIVETLNHELYECQYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAIIKCMMYYKEAFWKKKNYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKEIRKRKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATQWSGYMEGAVEAGERAAREILNALGKVSKKDIWLREPESED
VPAFEITRTFWERNLPSVTGLLKIIGFSTSVTALWLAVYKFRLLTRS
Download sequence
Identical sequences F1RX00
ENSSSCP00000013044 ENSSSCP00000013044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]