SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013074 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013074
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 3.49e-47
Family C-type lysozyme 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013074   Gene: ENSSSCG00000012285   Transcript: ENSSSCT00000013434
Sequence length 160
Comment pep:known chromosome:Sscrofa10.2:X:47046163:47048227:-1 gene:ENSSSCG00000012285 transcript:ENSSSCT00000013434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAWGSVVVTLTMLMAATVDAKIYERCELATKLEKAGLDGFKGYTTGDWLCMAHYESGFD
TSFVNHNPDGSSEYGIFQLNSAWWCDNGVTPTQNLCHMECHELLNRHILDDIMCAQQVVS
SQEGMNAWDSWSQHCSGHDLSEWLKGCHLNVKPDPKRIHS
Download sequence
Identical sequences D5K891
NP_001171401.1.46622 ENSSSCP00000013074 ENSSSCP00000013074 9823.ENSSSCP00000013074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]