SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013082 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013082
Domain Number 1 Region: 218-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000085
Family LIM domain 0.059
Further Details:      
 
Domain Number 2 Region: 278-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000107
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013082
Domain Number - Region: 182-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0357
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013082   Gene: ENSSSCG00000012293   Transcript: ENSSSCT00000013442
Sequence length 622
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:48066410:48078264:-1 gene:ENSSSCG00000012293 transcript:ENSSSCT00000013442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHA
VPVDLERIMCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYV
NSPGEKYRIKQLLHQLPPHDSEVQYCTALEEEEKKELRAFSQQRKRENLGRGTVRIFPVT
ITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCSTCRELLVDLIYFYHAGKVYCG
RHHAERLRPRCQACDEIIFSPECTEAEGRHWHMGHFCCFECEASLGGQRYVMRQSRPHCC
ACYEARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLI
FCSRACSLGSEPTAPGPGRRSWSAGTVSTPLAASTASFSAVEGASETTTKGTSTEPASAA
GPEEPARFLRGAPHRHSMPELGLRSAPEPPSGPPGQPDPHPEDGAFGRQSAPRVSFRDPL
VSDGGPRRTLSAPPAQRRRPRSPPPRAPTRRRHRRHHHHHHHHHHHHHHRRHSSRRRHHQ
CDSGSGSDSGSCSSSSTSPSSESSEDDGFFLGERIPLPPHLCRSVPARDTAAETPNSPSP
QLPGTSRPGMSRQARDKNCIVA
Download sequence
Identical sequences F1RW44
XP_003135128.1.46622 ENSSSCP00000013082 ENSSSCP00000030387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]