SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013108 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013108
Domain Number 1 Region: 255-499
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.76e-63
Family G proteins 0.0000000833
Further Details:      
 
Domain Number 2 Region: 577-680
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.43e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 481-571
Classification Level Classification E-value
Superfamily Translation proteins 2.29e-21
Family Elongation factors 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013108   Gene: ENSSSCG00000012317   Transcript: ENSSSCT00000013468
Sequence length 684
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:50566477:50569071:-1 gene:ENSSSCG00000012317 transcript:ENSSSCT00000013468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRWDPAASALLRFVTLPPEPSALAASPPAAPARSFWPVDPAPSPHPSGLRTMDLGSSSS
DSAPDCWDQVDMEAPGLAPSGDPGSPLAAAAAAAEAQREPLSSAFSRQLNVNAKPFVPNV
HAAEFVPSFLRGPGQPQTPPADATGIDETCPGAGDPQGKRLGRGAPVEHSKEEQLVLREG
SNAAVTMELSEPVVENGEVEMVLEESWEHNKEVSEAEPGGSSLGDSGPPEESGQEMMEKE
EIRKSKSLVVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKE
KNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQ
ADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKYLIVLINKMDDPTVNWSSERYE
ECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPYLDNMPNFN
RSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDAETDY
VAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDVQIVIIEHKSIICPGYNAVLH
IHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMG
RFTLRDEGKTIAIGKVLKLVPEKD
Download sequence
Identical sequences XP_003135149.3.46622 ENSSSCP00000013108 ENSSSCP00000013108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]