SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013166 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013166
Domain Number 1 Region: 650-894
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 533-610
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-25
Family Nuclear receptor 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013166   Gene: ENSSSCG00000012371   Transcript: ENSSSCT00000013528
Sequence length 896
Comment pep:known chromosome:Sscrofa10.2:X:60313335:60504856:1 gene:ENSSSCG00000012371 transcript:ENSSSCT00000013528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRVYPRPPSKTFRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGARLQQQQLQ
QQETSPRRQQQQQQQPSEDGSPQVQSRGPTGYLALDEKQQPSQQQSAPECHPESGCTPEP
GAASAASKGLQQQPPAPPDEDDSAAPSTLSLLGPTFPGLSSCSTDLKDILSEAGTMQLLQ
QQQQQQQQQEAVSEGNSSGRAREATGAPISSKDSYLGGSSTISDSAKELCKAVSVSMGLG
VEALEHLSPGEQLRGDCMYAPLLTGPPSVRPTPCAPLAECKGSLLDDGPGKSNEETAEYS
PFKAGYTKGLDSESLGCSSGGEAGGSGTLELPSALSLYKSGALDDVAAYPSRDYYNFPLA
LAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGGGASGPGSGSPSAT
SSSSWHTLFTAEESQLYGPCGGGGGGSAGEAGAVAPYGYTRPPQGLAGQEGDLAIPDIWY
PGGVVSRVPYPSPSCVKSEMGPWMESYSGPYGDMRLEPTRDHVLPIDYYFPPQKTCLICG
DEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAG
MTLGARKLKKLGNLKLQEEGEASSATSPTEEPAQKLTVSHIEGYECQPIFLNVLEAIEPG
VVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMG
LMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQE
FLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLL
DSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences F1RTM6
XP_013841681.1.46622 ENSSSCP00000013166 ENSSSCP00000013166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]