SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013367 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013367
Domain Number 1 Region: 109-208
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.34e-27
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000038
Further Details:      
 
Domain Number 2 Region: 12-143
Classification Level Classification E-value
Superfamily Translation proteins 1.1e-18
Family Elongation factors 0.0000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013367   Gene: ENSSSCG00000012570   Transcript: ENSSSCT00000013745
Sequence length 229
Comment pep:novel chromosome:Sscrofa10.2:X:103012164:103013065:1 gene:ENSSSCG00000012570 transcript:ENSSSCT00000013745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMKAPGRETELFPLRFTKRTSAKNGGIDTVPMGRVDTGVLRLGMVLIFAPVNVTHEVTSI
EMHHEALRTALPEDSVAFNVKNMSVKDVRCVNVANNSKNAPQPPPKEAAGFTNQVIILNR
PSQLGAGGAPVLDCHPAPTACKFAGWKEKIGKSWKTASNFFKSGDASIVDMVPGKPMCVE
SFSDYPPLGHFAVHDMRQMVAVGVIKAVDKKAAGGGKVTKSAQKALKAK
Download sequence
Identical sequences ENSSSCP00000013367 ENSSSCP00000013367 9823.ENSSSCP00000013367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]