SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013456 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013456
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.65e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000239
Further Details:      
 
Domain Number 2 Region: 125-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.53e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000383
Further Details:      
 
Domain Number 3 Region: 299-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.4e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013456   Gene: ENSSSCG00000012657   Transcript: ENSSSCT00000013838
Sequence length 613
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:122439445:122476820:-1 gene:ENSSSCG00000012657 transcript:ENSSSCT00000013838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLAPLVRTVCVRGPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNTVLVLFVGLSTIGAGAYAYRTIKDNKKRYNERIAGLGLTPEEKQKRATSSAPEG
EPVPQVRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFRQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRG
NMAKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRTLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVLPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEAPE
ITLPVGSPAVPQAPTQGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences A0A0B8RTX7 F1RTH3
ENSSSCP00000013456 9823.ENSSSCP00000013456 ENSSSCP00000013456 ENSSSCP00000030452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]