SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013501 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013501
Domain Number 1 Region: 145-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.02e-17
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 204-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 83-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000143
Family LIM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 23-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000135
Family LIM domain 0.0027
Further Details:      
 
Domain Number 5 Region: 268-295
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000028
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013501   Gene: ENSSSCG00000012699   Transcript: ENSSSCT00000013884
Sequence length 296
Comment pep:known chromosome:Sscrofa10.2:X:127278177:127289862:1 gene:ENSSSCG00000012699 transcript:ENSSSCT00000013884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHRHAGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRYWHDTCFRCSKCLHPLANETFMAKDNKILCNKCTTREDSPKCKGC
FKPIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL
Download sequence
Identical sequences Q9GJV4
NP_999540.1.46622 ENSSSCP00000013501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]