SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013714 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013714
Domain Number 1 Region: 65-192
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.54e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.000000374
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000018
Family Glutathione S-transferase (GST), N-terminal domain 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013714   Gene: ENSSSCG00000012897   Transcript: ENSSSCT00000014100
Sequence length 196
Comment pep:known chromosome:Sscrofa10.2:2:3618668:3620934:-1 gene:ENSSSCG00000012897 transcript:ENSSSCT00000014100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRCEAMRMLLADQDQSWKEEVVTMETWPPLKPSCLFRQLPKFQDGDLTLYQSNAILRHLG
RSFGLYGKDQKEAALVDMVNDGVEDLRCKYATLIYTNYEAGKEKYVKELPEHLKPFETLL
SQNQGGQAFVVGSQISFADYNLLDLLRIHQVLNPSCLDAFPLLSAYVARLSARPKIKAFL
ASPEHVNRPINGNGKQ
Download sequence
Identical sequences ENSSSCP00000013714 ENSSSCP00000013714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]