SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013865 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013865
Domain Number 1 Region: 31-102
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.19e-21
Family Chaperone J-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013865   Gene: ENSSSCG00000013038   Transcript: ENSSSCT00000014251
Sequence length 240
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:6943440:6947235:-1 gene:ENSSSCG00000013038 transcript:ENSSSCT00000014251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPAAMLPLRLCRLWPRNPPARSFAAAAGQRSGPSNYYELLGVHPGASAEEVKRAFFSKS
KELHPDRDPGNPALHSRFVELSEAYQVLSREESRRSYDHQLRSATSPKSPGTSAYPRSAH
RAHSSWEDPSARYWAQFPGVRPQGPELRRQQQKHNQRTLGYCLLIMLAGMCLHYVAFRKL
EQVHRSFMDEKDRIITAIYNDTRARARAKRARLQQEQQQRQLLQPTPGPPEGPGIVPPSP
Download sequence
Identical sequences ENSSSCP00000013865 ENSSSCP00000013865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]