SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013892 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013892
Domain Number 1 Region: 267-319
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000418
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013892
Domain Number - Region: 364-407
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00228
Family Erythroid transcription factor GATA-1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013892   Gene: ENSSSCG00000013062   Transcript: ENSSSCT00000014278
Sequence length 667
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:8484044:8492563:1 gene:ENSSSCG00000013062 transcript:ENSSSCT00000014278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISGSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRRGKCSVTLLNETDILSQ
YLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLAEGESDNRNQQKMEMKVW
DPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQ
RNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKS
LASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGA
GFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTE
PHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAA
RRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTK
TPINRNQLTQNRGLGSIMVKRAYETMAGVPFSANGRPLASGIRSSSQPATKRQKLNPADA
PNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPPLITVRAPVSLPPSAHPASTN
EPIVLED
Download sequence
Identical sequences ENSSSCP00000013892 ENSSSCP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]