SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014190 from Sus scrofa 76_10.2

(show help)
Strong hits

Sequence:	ENSSSCP00000014190
Domain Number 1	Region: 104-145
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	9.98e-17
Family	LIM domain	0.0068
Further Details:

Domain Number 2	Region: 37-83
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000041
Family	LIM domain	0.00072
Further Details:

Domain Number 3	Region: 146-188
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000235
Family	LIM domain	0.0011
Further Details:

Domain Number 4	Region: 9-35
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000105
Family	LIM domain	0.0065
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSSSCP00000014190 Gene: ENSSSCG00000013354 Transcript: ENSSSCT00000014585
Sequence length	194
Comment	pep:known chromosome:Sscrofa10.2:2:43258339:43279704:-1 gene:ENSSSCG00000013354 transcript:ENSSSCT00000014585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSATTSNPSKFTAKFGESEKC PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG IGFGGLTHQVEKKE
Download sequence
Identical sequences	D2SQP3 ENSSSCP00000014190 ENSSSCP00000014190 NP_001165839.1.46622 9823.ENSSSCP00000014190

SEARCH