SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014190 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014190
Domain Number 1 Region: 104-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-17
Family LIM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000041
Family LIM domain 0.00072
Further Details:      
 
Domain Number 3 Region: 146-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000235
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000105
Family LIM domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014190   Gene: ENSSSCG00000013354   Transcript: ENSSSCT00000014585
Sequence length 194
Comment pep:known chromosome:Sscrofa10.2:2:43258339:43279704:-1 gene:ENSSSCG00000013354 transcript:ENSSSCT00000014585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSATTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTHQVEKKE
Download sequence
Identical sequences D2SQP3
9823.ENSSSCP00000014190 ENSSSCP00000014190 NP_001165839.1.46622 ENSSSCP00000014190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]