SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014264 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014264
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-51
Family Eukaryotic proteases 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014264   Gene: ENSSSCG00000013415   Transcript: ENSSSCT00000014659
Sequence length 219
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:78284635:78287017:-1 gene:ENSSSCG00000013415 transcript:ENSSSCT00000014659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGGRRAQPQEFPFLASIQKQGRPFCAGALVHPRFVLTAASCFRGKNSGSASVVLGAYDL
RQQEQSRQTFSIRSISQNGYDPRQNLNDVLLLQLDREARLTPSVALVPLPPQNATVEAGT
NCQVAGWGTQRLRRLFSRFPRVLNVTVTSNPCLPRDMCIGVFSRRGRISQGDRGTPLVCN
GLAQGVASFLRRRFRRSSGFFTRVALFRNWIDSVLNNPP
Download sequence
Identical sequences ENSSSCP00000014264 ENSSSCP00000014264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]