SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014481 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014481
Domain Number 1 Region: 413-522
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.49e-19
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000106
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014481
Domain Number - Region: 208-256
Classification Level Classification E-value
Superfamily EF-hand 0.00011
Family Calmodulin-like 0.088
Further Details:      
 
Domain Number - Region: 30-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000262
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 125-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.045
Family FCH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014481   Gene: ENSSSCG00000013627   Transcript: ENSSSCT00000014882
Sequence length 537
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:70332816:70349574:-1 gene:ENSSSCG00000013627 transcript:ENSSSCT00000014882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSASIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCSNTGYKPLYISSRWVNDGVCDCCDGTDEYNSGIVCENTCKEKGR
KERETLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIEIQAGKKSLEDQVEMLRAVKE
EAEKPEKEAKDQHRKLWEEQQAASKAQREQELAANAFQELDDDMDGVVSVAELQTHPELD
TDGDGALSEGEAQTLLGGDSQTDAASFYDRIWAAIRDKYRSEVPPTDVPSPSAPDLTEPK
EEQPPVPSPPTEEEDEDQDEEEEETEEEEEEEEEEDSQVQAEQPKEAPPPLVTPQTVSPT
EEDKMPPYDEQTQAFIDAAQEARNKFEEAERSLRDMEESIRNLEQEISFDFGPDGEFAYL
YSQCYELTTNEYVYRLCPFKHVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGC
WQGPNRSTTVRLLCGRETVVTSTTEPSRCEYLMELTTPAACPEPPPEPPTEGDHDEL
Download sequence
Identical sequences F1S596
ENSSSCP00000014481 ENSSSCP00000014481 9823.ENSSSCP00000014481 NP_001231527.1.46622 XP_005654813.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]