SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014708 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014708
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily Caspase-like 1.02e-63
Family Caspase catalytic domain 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014708   Gene: ENSSSCG00000013835   Transcript: ENSSSCT00000015113
Sequence length 246
Comment pep:known chromosome:Sscrofa10.2:2:62082531:62085517:-1 gene:ENSSSCG00000013835 transcript:ENSSSCT00000015113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSEDMSNPQPLEEEAYDMSGARLALTLCVTKAREGSQADLDALESMFQQLRFESTMKKDP
TAQQFYEELEKFQQAIDAREDFVSCAFVVLMAHGLEGRLKGEDGKMVDLEDLFQVLNNKN
CRGLRARPKVYIVQACRGEQRDPGEPIGGEDLVMIAKSSPETIPTYTDTLHVYSTVEGYI
AYRHDQEGSYFIQTLVDVFMNRRGPILELLTEVTRRMAEEELFQEGKPRKVNPEIYSTLR
KRLYLQ
Download sequence
Identical sequences 9823.ENSSSCP00000014708 ENSSSCP00000014708 ENSSSCP00000014708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]