SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014897 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014897
Domain Number 1 Region: 254-617
Classification Level Classification E-value
Superfamily SIS domain 5.38e-101
Family double-SIS domain 0.000000567
Further Details:      
 
Domain Number 2 Region: 6-134,185-229
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.42e-41
Family Class II glutamine amidotransferases 0.0000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014897   Gene: ENSSSCG00000014012   Transcript: ENSSSCT00000015305
Sequence length 617
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:79770223:79812473:1 gene:ENSSSCG00000014012 transcript:ENSSSCT00000015305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLES
KGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEA
VATRRGSPLLIGVRSKYKLSTEQVPILYRTRDCDPFLPVLGNIENVKNICKTRMKRLDSS
TCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSR
AIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIR
RCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSG
ETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFIS
LVMFGLMMSEDRISLQNRRREIIHGLKSLPVFLSFFLSFEKCIDKPVTETRQRKEVLVMG
RGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQN
ALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLR
GYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSSSCP00000014897 ENSSSCP00000014897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]