SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015055 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015055
Domain Number 1 Region: 151-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-70
Family Nuclear receptor ligand-binding domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 83-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015055   Gene: ENSSSCG00000014157   Transcript: ENSSSCT00000015465
Sequence length 422
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:103838947:103848870:1 gene:ENSSSCG00000014157 transcript:ENSSSCT00000015465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGAGEQQQQAGSGAPHTPQTPGQPGAP
ATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYT
CRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNG
HCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFP
DLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRI
FQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYP
NQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
CS
Download sequence
Identical sequences A0A287AV73 A0A2K6FDA4
ENSSSCP00000015055 ENSSSCP00000015055 XP_003354261.1.46622 XP_012500237.1.63892 XP_012607258.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]