SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015358 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015358
Domain Number 1 Region: 612-688
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 3.79e-29
Family VHP, Villin headpiece domain 0.00000718
Further Details:      
 
Domain Number 2 Region: 103-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000349
Family LIM domain 0.0018
Further Details:      
 
Domain Number 3 Region: 47-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000608
Family LIM domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015358
Domain Number - Region: 18-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000119
Family LIM domain 0.022
Further Details:      
 
Domain Number - Region: 184-228
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0057
Family LIM domain 0.014
Further Details:      
 
Domain Number - Region: 244-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0128
Family LIM domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015358   Gene: ENSSSCG00000014430   Transcript: ENSSSCT00000015774
Sequence length 688
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:157099050:157184617:1 gene:ENSSSCG00000014430 transcript:ENSSSCT00000015774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STVPYQQNPYAPRGGSSVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLQSGFFF
KNQEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTF
SGKECLCQTCSQSMTSSKPIKIRGPSQSLVCLEFLAHAQHGARQGRRCDGKTRQAQTRSL
PLGRRARRDGVPYCESDYHSYRGAPCRHNHRRRRGRKLNPAGGKHYHPFRLRSCSRHPAP
RAWRVFIEGRDITLSPVGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVI
CAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSP
YSQDIYENLDLRQRRASSPGYIDSPSYSRQGLSPTFSRSPHHYYRSGPESGRSSPYHSQL
DVRSSTPTSYQAPKHFHIPAGESNIYRKPPIYRRSGDLSTATKSKTSEDISQASKYSPGY
SPDPYYAAESEYWTYHGSPKVPRARRFSSGGEEDEFDRSMQKLQSGIGRLILKEEMRARS
SSYADPWAPPRSSTSSREALHTAGCELSLNGSPRSHYLADSDPLISKSASLPAYRRNGLH
RTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFY
QVFGMTISEFDRLALWKRNELKKQARLF
Download sequence
Identical sequences ENSSSCP00000015358 ENSSSCP00000015358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]