SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015367 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015367
Domain Number 1 Region: 486-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.77e-110
Family PDEase 0.000000274
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 4.91e-32
Family GAF domain 0.00038
Further Details:      
 
Domain Number 3 Region: 237-281,308-458
Classification Level Classification E-value
Superfamily GAF domain-like 4.91e-30
Family GAF domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015367   Gene: ENSSSCG00000014438   Transcript: ENSSSCT00000015783
Sequence length 857
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:157742440:157800107:-1 gene:ENSSSCG00000014438 transcript:ENSSSCT00000015783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNVGFAKRYFNLRYRPKVISELLGAREAAVDLSHYHPLNSVEESEV
VFDLLRDFQENLQAEKCIFNVMKKLSFLLQADRMSLFMHRARNGTAELATRLFNVHKDAV
LEDCLVAPDSEIVFPLDMGVVGHVALSKKMVNVPNAQEDEHFCDFVDKLTEYQTKHLLAS
PIMNGKDVVAVLMAVNKVDGPHFTQRDEEILVKYLNFANIIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYSGPRTPDGREISFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDDMDETLM
ESLAQFLGWSVLNPDTYESMNKLENRKDIFQDMVKYHVKCDNEEIQKILKTRETYGKEPW
ECEEDELAEILREELPDAEKYEISKFHFSDLPLTELELVKCGIRMYYELRVVDKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYETQQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERSVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRREWKALADAYDAKTKAQEEEKQKQPAASQAATGN
QPGSAGDAPASKSCSIQ
Download sequence
Identical sequences ENSSSCP00000015367 ENSSSCP00000015367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]