SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015530 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015530
Domain Number 1 Region: 43-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.97e-34
Family SCAN domain 0.0000872
Further Details:      
 
Domain Number 2 Region: 163-207
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-17
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015530   Gene: ENSSSCG00000014600   Transcript: ENSSSCT00000015950
Sequence length 239
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:3065249:3077501:1 gene:ENSSSCG00000014600 transcript:ENSSSCT00000015950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPLTKLMAVLKPPNLAPHEESEVLRADVSWQQEPIPVMETDDSEASRQKFRHFRCLEVS
GPYEALSQLWELCLRWLRPEIHTKKQILELLVLEQFLTVLPEEVRTWVNLQHPKNSREVV
SLIGDVVDLLKDEGRSCTEPVLPPKGSIAQEALEADLPAGRGQEPVAFKEVVVEFSEEEW
EQLGPAGRTLCRDVMLETYRNLSSLRKERLLSKPAEISELQSQTTACMMEPEVPRTAVL
Download sequence
Identical sequences ENSSSCP00000015530 9823.ENSSSCP00000015530 ENSSSCP00000015530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]