SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015734 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015734
Domain Number 1 Region: 508-857
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-110
Family PDEase 0.00000226
Further Details:      
 
Domain Number 2 Region: 321-503
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 151-334
Classification Level Classification E-value
Superfamily GAF domain-like 1.61e-35
Family GAF domain 0.0000000173
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015734
Domain Number - Region: 5-123
Classification Level Classification E-value
Superfamily GAF domain-like 0.000196
Family GAF domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015734   Gene: ENSSSCG00000014816   Transcript: ENSSSCT00000016167
Sequence length 868
Comment pep:known chromosome:Sscrofa10.2:9:7720894:7750232:1 gene:ENSSSCG00000014816 transcript:ENSSSCT00000016167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSQETVYTYLRDGESRLVCEEPCHELPQEGKVREAVISRKRVGCNGLSPSDLQGRPLAR
LVAPLAPDTQVLVIPLVDEEAGALAAVVLVHCGQLSDSDEWSLQAVEKHTLVALKRVQAL
QQRGPGAAPEAAQKPPEGVAGDQKGGVGYTDQDRKILQLCGELYDLDASSLQLKVLQYLQ
QETQASRCCLLLVSEDNLQLSCKVIGDKVLQEETSFPLTTGRLGQVVEDKKSIQLQDLTS
EDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDEHVIQHCFHYT
STVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVF
LLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDD
STGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLL
YKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDTNFASFTYTPRSLPED
DTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYK
NLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQ
AIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRTNK
QHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKA
YIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSL
DFLDEEYEMHELGSARAPVNGCCSLDAE
Download sequence
Identical sequences ENSSSCP00000015734 ENSSSCP00000015734 9823.ENSSSCP00000015734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]