SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015785 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015785
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000113
Family THAP domain 0.0022
Further Details:      
 
Domain Number 2 Region: 250-530,582-730
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000205
Family Hermes transposase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015785   Gene: ENSSSCG00000014865   Transcript: ENSSSCT00000016218
Sequence length 762
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:11652415:11669844:-1 gene:ENSSSCG00000014865 transcript:ENSSSCT00000016218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFCAAPNCTRKSTQSDLAFFRFPRDPASCLRWGDNGGGAGYAIRTPENRQTQFCMRHH
QFSSFICKSKSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKID
ETSEQEQKHKEINNSNAQNPGAEEGGEEQDEDVLPLTLEEKENKEYLKSLFEILILMGKQ
NIPLDGHEADDIPEGLFTPDNFQALLECRINAGEEVLRKRFETTAVNTLFCSKTQQKQML
EICESCVREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDEAHNLREEFVGFLPY
EADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLC
SSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDSVISVLFQNNEERGKEL
KEICHSQWTGRHDAFEILVDLLQALVLCLDGINSDTNIRWNNCIAGRAFVLCSAVTDFDF
IVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEA
TNLATKLDIQMKLPGKFRRAQHSNLDSQLTSESYYKETLSVPTVEHIIQELKDIFSEQHL
KALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELP
STIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSN
LALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNAEPIENT
Download sequence
Identical sequences ENSSSCP00000015785 ENSSSCP00000015785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]