SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015859 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015859
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.94e-80
Family G proteins 0.0000000096
Further Details:      
 
Domain Number 2 Region: 338-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.88e-43
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000349
Further Details:      
 
Domain Number 3 Region: 238-334
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-29
Family Elongation factors 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015859   Gene: ENSSSCG00000022342   Transcript: ENSSSCT00000016295
Sequence length 461
Comment pep:novel chromosome:Sscrofa10.2:9:28754240:28756842:-1 gene:ENSSSCG00000022342 transcript:ENSSSCT00000016295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAFTLGVKQLIVAVNKMDSTEPAFSAARFQEITKEVSNYIKK
IGYNPASVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNATGVTLLEALDSILPPTR
PVNKPLRLPLQDVYKIGGIGTVPVGRVETGFLKAGMVVTFAPNNVTTEVKSVEMHHEALA
EALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEASSFVAQVIVLNHPGQIHAGYSPV
LDCHTAHISCKFAELREKMDRRSGKKLEDNPKALKSGDAAMVQMVPSKAMCVETFSQYPP
LGRFAVRDMRQTVAVGVIKAVEKKTATTTKVTKAAVKASKK
Download sequence
Identical sequences 9823.ENSSSCP00000015859 ENSSSCP00000015859 ENSSSCP00000015859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]