SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015888 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015888
Domain Number 1 Region: 86-307
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.75e-34
Family PhyH-like 0.079
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015888
Domain Number - Region: 9-53
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.0255
Family Retrovirus capsid protein, N-terminal core domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015888   Gene: ENSSSCG00000014964   Transcript: ENSSSCT00000016325
Sequence length 507
Comment pep:novel chromosome:Sscrofa10.2:9:30847305:30848825:1 gene:ENSSSCG00000014964 transcript:ENSSSCT00000016325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRPCGVQNPGCAIMTFYPTLEEFEDFSQYIAYMESQGAHHAGLAKVIPPKGWKARQTY
EDISDIVIAAPLQQVAFGEAGVFTQYHRKKRAMTVSQYHHLAHTVKYQAPPHLDFEDLEQ
TYWKTRLYGSPIYGADVSGSLFDENTKQWNLGHLGTIQDLLEQECGVAIDGVNSPYLYFG
MWKTGFAWHTEDMDLYSLNFLHFGEPKTWYAVPPAHGRRLERLARELFPGPARGCEAFLR
HKVALISPTVLKAQGIPFGRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRWVDY
GKVASQCSCGEARVVFSMDAFVRILQPERYELWKRGQDRVALEHTEHLSSPGSLELSAWR
EVREPAGAELGLGHSPPHTARGRLWVAGRGIRRRNSVCSVSRCPSPTWGSSSAAQFQVAT
LCSSHEPGPTPPLSPGSSALGLQSTGRRGPVRCRRSRPHRRPRVQETLEPTVQAPAKRLL
SVGTVGTAADLEAHVLLAKEPLIDSPA
Download sequence
Identical sequences ENSSSCP00000015888 ENSSSCP00000015888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]