SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015900 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015900
Domain Number 1 Region: 617-643,674-913
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-62
Family Nuclear receptor ligand-binding domain 0.00000000141
Further Details:      
 
Domain Number 2 Region: 564-642
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-22
Family Nuclear receptor 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015900   Gene: ENSSSCG00000014977   Transcript: ENSSSCT00000016339
Sequence length 933
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:36044789:36137513:-1 gene:ENSSSCG00000014977 transcript:ENSSSCT00000016339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELKAKDPRAPHVAGRAPSPTQLGTLGRPDTGPFQASQTSEASPAASAIPLSLDGLLFP
GPCQGQEPDGKTQDQQSLSDVEGAYPRVEATEGAGGGSSRPSEKDTGLLDSVLDTLLAPS
GPGQSHASPPACEATSPWCLFGSELPQDARVAPSTQGVLPLLMSRPEGKAGDSSGTAAAH
KVLSRGLAPSRQLLPSTAGSHHWPAAAVKPSPQPAVVEVEEEDDSESEGSMVPLLKGKPR
PAGGTAAGTGTPTGAPGTAAGGVALVPKEDARFSAPRGALAEHDASGAPGRSPLATTVMD
FIHVPILPLNTAFLAARTRQLLEGDNYDGGAPAVSAFAPPRGSPSAPSASVTAGDFPDCA
YSADDEPKDDAFPLYGDFQPPALKIKEEEEGAEAAARSPRSYLVAGANPAVFPDFPLAPP
SLPPRASSRPGEASAAVAPTSASVSSASSSGSALECMYKAEGAPPQQGPFPPPPCKPPSA
GACLLPRDSLPSTSASAAAAAAAAAGAAPALYQPLGLNGLPQLGYQAAVLKEGLPQVYQP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFLKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPQSG
GIPNESQALSQRITFSPNQDLQLIPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQNQ
FEEMRSSYIRELIKAIGLRQKGVVPSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences ENSSSCP00000015900 ENSSSCP00000015900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]