SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015921 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015921
Domain Number 1 Region: 24-280
Classification Level Classification E-value
Superfamily Caspase-like 1e-69
Family Caspase catalytic domain 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015921   Gene: ENSSSCG00000014996   Transcript: ENSSSCT00000016360
Sequence length 281
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:39176890:39183684:-1 gene:ENSSSCG00000014996 transcript:ENSSSCT00000016360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QETQDSQRRKLKLCPGDHFHKLKTKTDEIHPVKEKEGRTRLLIICSKEFDYLFNQYGSEV
DLLGMQDLLENLGYSVVVKEDLTALEMETALRQFAARQDHQSSDSTFLVFMSHGILDGIC
GTKHREQQPYILHDDTIFQIFNNHNCQSLKDKPKVILMQACRGKGAGIVWVTDMGKNSAY
RYGQSLQCSIWNDAITKTHVEKDFIAFKSSTPHYIIMRIKSNGSLFISKRIYYLKEYSLC
HHLEEIFRKVQHSFETPDVLTQMPTIERVSMTRYFYLFPGN
Download sequence
Identical sequences ENSSSCP00000015921 ENSSSCP00000015921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]