SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016042 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016042
Domain Number 1 Region: 288-402
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-33
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 132-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 3 Region: 453-565
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.41e-28
Family Frizzled cysteine-rich domain 0.0003
Further Details:      
 
Domain Number 4 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016042
Domain Number - Region: 408-441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000812
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016042   Gene: ENSSSCG00000015119   Transcript: ENSSSCT00000016485
Sequence length 568
Comment pep:novel chromosome:Sscrofa10.2:9:51585082:51590214:-1 gene:ENSSSCG00000015119 transcript:ENSSSCT00000016485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDCSDIILCVETTELSKTEFCNPAFEPESGLPRPPPAFREDPSGRFRAPWHGQRPRGLQ
PDCRFSWLCVLLLASLLLLLLGLLVAIILAQLQAASPSEAAFHLPPSRGFTTTGAPKGQL
EAGMSPTPQSTCGGLLPGPRGFFNSPNYPDPYPPNTYCVWHIQVATDHAIQLKIEALSIE
GVASCLFDRLEISPEPEGPLLRVCGRVPPPTLNTNASHLQVAFVSDSSVEGSGFHAWYQA
VAPGHGSCAHDEFPCDQLVCLLPDSVCDGFANCADGSDETNCSAKFSGCGGNLTGLQGML
SAPIYLQQYPHHQLCTWHISVPAGHGIELQFHNFSLDTQDACKFDYVEVYETSNSGALSL
LGRFCGAEPPPQRLISSYHQLAVLFRTDHGISGGGFSATYQALNATEKPCGPGELSCRDA
GCKSLQWMCGLWRDCAESSGDNCSSPLFPPPELACEPVQVEMCIGLSYNTTAFPNIWVGM
ATQEEVVELLRGYKSLTSLPCYQNFRRLLCGLLVPHCTPLGSVLPPCRSVCQEAERQCQS
GLALLGTPWPFNCNRLPEAAGLESCAQP
Download sequence
Identical sequences F1SAF7
ENSSSCP00000016042 XP_003129989.1.46622 ENSSSCP00000016042 9823.ENSSSCP00000016042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]